Structure of PDB 7yaa Chain A Binding Site BS01

Receptor Information
>7yaa Chain A (length=141) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MSQSNRELVVDFLSYKLSQKGYSWSQPMAAVKQALREAGDEFELRYRRAF
SDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESV
DKEMQVLVSRIASWMATYLNDHLEPWIQENGGWDTFVDLYG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7yaa Cyclic peptides discriminate BCL-2 and its clinical mutants from BCL-xL by engaging a single-residue discrepancy
Resolution1.4 Å
Binding residue
(original residue number in PDB)		F42 Y46 A49 E74 L75 R77 D78 N81 G83 R84 Y140
Binding residue
(residue number reindexed from 1)		F42 Y46 A49 E74 L75 R77 D78 N81 G83 R84 Y140
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:7yaa, PDBe:7yaa, PDBj:7yaa
PDBsum7yaa
PubMed38368459
UniProtQ07817|B2CL1_HUMAN Bcl-2-like protein 1 (Gene Name=BCL2L1)

[Back to BioLiP]