Structure of PDB 7ya5 Chain A Binding Site BS01

Receptor Information
>7ya5 Chain A (length=139) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GYDNREIVMKYIHYKLSQRGYEWDESEVVHLTLRQAVDDFSRRYRRDFAE
MSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNR
EMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7ya5 Cyclic peptides discriminate BCL-2 and its clinical mutants from BCL-xL by engaging a single-residue discrepancy
Resolution1.85 Å
Binding residue
(original residue number in PDB)		F104 R107 Y108 D111 F112 E136 L137 D140 G141 N143 G145 R146 A149
Binding residue
(residue number reindexed from 1)		F40 R43 Y44 D47 F48 E72 L73 D76 G77 N79 G81 R82 A85
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process
GO:0043066 negative regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:7ya5, PDBe:7ya5, PDBj:7ya5
PDBsum7ya5
PubMed38368459
UniProtP10415|BCL2_HUMAN Apoptosis regulator Bcl-2 (Gene Name=BCL2)

[Back to BioLiP]