Structure of PDB 7y99 Chain A Binding Site BS01

Receptor Information
>7y99 Chain A (length=140) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SQSNRELVVDFLSYKLSQKGYSWSQPMAAVKQALREAGDEFELRYRRAFS
DLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVD
KEMQVLVSRIASWMATYLNDHLEPWIQENGGWDTFVDLYG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7y99 Cyclic peptides discriminate BCL-2 and its clinical mutants from BCL-xL by engaging a single-residue discrepancy
Resolution1.9 Å
Binding residue
(original residue number in PDB)		E41 F42 Y46 R48 A49 E74 L75 R77 D78 G83 R84 Y140
Binding residue
(residue number reindexed from 1)		E40 F41 Y45 R47 A48 E73 L74 R76 D77 G82 R83 Y139
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:7y99, PDBe:7y99, PDBj:7y99
PDBsum7y99
PubMed38368459
UniProtQ64373|B2CL1_MOUSE Bcl-2-like protein 1 (Gene Name=Bcl2l1)

[Back to BioLiP]