Structure of PDB 7y43 Chain A Binding Site BS01

Receptor Information
>7y43 Chain A (length=79) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KLANPLYTEWILEAIKKVKKQKQRPSEERICNAVSSSHGLDRKTVLEQLE
LSVKDGTILKVSNKGLNSYKDPDNPGRIA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7y43 The histone acetyltransferase KAT6A is recruited to unmethylated CpG islands via a DNA binding winged helix domain.
Resolution1.5 Å
Binding residue
(original residue number in PDB)		K19 Q23 K24 Q25 N34 R79
Binding residue
(residue number reindexed from 1)		K17 Q21 K22 Q23 N32 R77
Enzymatic activity
Enzyme Commision number 2.3.1.48: histone acetyltransferase.
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:7y43, PDBe:7y43, PDBj:7y43
PDBsum7y43
PubMed36537216
UniProtQ92794|KAT6A_HUMAN Histone acetyltransferase KAT6A (Gene Name=KAT6A)

[Back to BioLiP]