Structure of PDB 7y01 Chain A Binding Site BS01

Receptor Information
>7y01 Chain A (length=171) Species: 4577 (Zea mays) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
STEILVDKYSGLRIKHLTLSPLEISNRFADIRFVRITALKNSVGSDRFSG
CWATAGVLLDKGVQRVSAKGSSYSIWKMGALDETDVSLFLFGDAHVHYSG
AAVGSVFAVFNGNVRMDNGGKGFSMSVASVGQMLKMGVASDFGLCKGKRK
DGVACTMAINKSKGSYCKFHS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7y01 AtMCM10 promotes DNA replication-coupled nucleosome assembly in Arabidopsis.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		D140 R145 S147 A148 K149 Y153 I155 S167 F169 F171 R195 K201 R229 C235 T236 M237 F249
Binding residue
(residue number reindexed from 1)		D60 R65 S67 A68 K69 Y73 I75 S87 F89 F91 R115 K121 R149 C155 T156 M157 F169
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003690 double-stranded DNA binding
GO:0003697 single-stranded DNA binding
Biological Process
GO:0006260 DNA replication
GO:0006270 DNA replication initiation
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7y01, PDBe:7y01, PDBj:7y01
PDBsum7y01
PubMed36541721
UniProtB6TE84

[Back to BioLiP]