Structure of PDB 7xwz Chain A Binding Site BS01

Receptor Information
>7xwz Chain A (length=112) Species: 2697049 (Severe acute respiratory syndrome coronavirus 2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NTASWFTALTQHGKEDLKFPRGQGVPINTNSSPDDQIGYYRRADLSPRWY
FYYLGTGPEAGLPYGANKDGIIWVATEGALNTPKDHIGTRNPANNAAIVL
QLPQGTTLPKGF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7xwz Antiviral drug design based on structural insights into the N-terminal domain and C-terminal domain of the SARS-CoV-2 nucleocapsid protein.
Resolution2.25 Å
Binding residue
(original residue number in PDB)		T49 A90 R107 Y109 Y111 P117
Binding residue
(residue number reindexed from 1)		T2 A43 R48 Y50 Y52 P58
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0019013 viral nucleocapsid

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:7xwz, PDBe:7xwz, PDBj:7xwz
PDBsum7xwz
PubMed36317101
UniProtP0DTC9|NCAP_SARS2 Nucleoprotein (Gene Name=N)

[Back to BioLiP]