Structure of PDB 7xv0 Chain A Binding Site BS01

Receptor Information
>7xv0 Chain A (length=121) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SMVGQLSEGAIAAIMQKGDTNIKPILQVINIRPITTGSPPRYRLLMSDGL
NTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELE
VLKSAEAVGVKIGNPVPYNEG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7xv0 Structural characterization of human RPA70N association with DNA damage response proteins.
Resolution1.5 Å
Binding residue
(original residue number in PDB)		I33 T34 R43 S55 F56 M57 L87 K88 R91 V93
Binding residue
(residue number reindexed from 1)		I34 T35 R43 S55 F56 M57 L87 K88 R91 V93
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006260 DNA replication
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7xv0, PDBe:7xv0, PDBj:7xv0
PDBsum7xv0
PubMed37668474
UniProtP27694|RFA1_HUMAN Replication protein A 70 kDa DNA-binding subunit (Gene Name=RPA1)

[Back to BioLiP]