Structure of PDB 7xqt Chain A Binding Site BS01

Receptor Information
>7xqt Chain A (length=274) Species: 9685 (Felis catus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHSLRYFHTAMSRPGLGEPRFISVGYVDNTQFVRFDSDAPNPKMEPRAP
WVEQVGPEYWDEETRNAKDNAQNFRVNLQTVLRYYNQSESGSHSLQRMYG
CDVGPDGCLLRGYSQVSYDGKDYISLNKDLRSWTAADTAAQITRLKWEEA
GVAEQERNYLEGTCVEWLAKYLDMGKETLLRAESPNTRMTRHPISDREVT
LRCWALGFYPAEITLTWQRDGQDHTQDAELVETRPAGDGTFQKWAAVVVP
SGEEQRYTCHVQHEGLPEPITLRW
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7xqt Analysis of the characteristics of feline major histocompatibility complex class I molecules cross-presenting coronavirus peptides
Resolution2.8 Å
Binding residue
(original residue number in PDB)
Y7 E63 N66 N70 N73 N77 Y84 L95 R97 Y99 V116 T143 K146 W147 Y159 W167 Y171
Binding residue
(residue number reindexed from 1)
Y7 E63 N66 N70 N73 N77 Y84 L95 R97 Y99 V116 T143 K146 W147 Y159 W167 Y171
Enzymatic activity
Enzyme Commision number ?
External links