Structure of PDB 7xqs Chain A Binding Site BS01

Receptor Information
>7xqs Chain A (length=274) Species: 9685 (Felis catus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHSLRYFHTAMSRPGLGEPRFISVGYVDNTQFVRFDSDAPNPKMEPRAP
WVEQVGPEYWDEETRNAKDNAQNFRVNLQTVLRYYNQSESGSHSLQRMYG
CDVGPDGCLLRGYSQVSYDGKDYISLNKDLRSWTAADTAAQITRLKWEEA
GVAEQERNYLEGTCVEWLAKYLDMGKETLLRAESPNTRMTRHPISDREVT
LRCWALGFYPAEITLTWQRDGQDHTQDAELVETRPAGDGTFQKWAAVVVP
SGEEQRYTCHVQHEGLPEPITLRW
Ligand information
>7xqs Chain C (length=9) Species: 2697049 (Severe acute respiratory syndrome coronavirus 2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RSFIEDLLF
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7xqs Analysis of the characteristics of feline major histocompatibility complex class I molecules cross-presenting coronavirus peptides
Resolution2.69 Å
Binding residue
(original residue number in PDB)
Y7 E63 N66 N73 N77 Y84 R97 Y99 V116 Y123 T143 K146 W147 E156 Y159 W167 Y171
Binding residue
(residue number reindexed from 1)
Y7 E63 N66 N73 N77 Y84 R97 Y99 V116 Y123 T143 K146 W147 E156 Y159 W167 Y171
Enzymatic activity
Enzyme Commision number ?
External links