Structure of PDB 7xpk Chain A Binding Site BS01

Receptor Information
>7xpk Chain A (length=159) Species: 39947 (Oryza sativa Japonica Group) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GGIKMDTQFYDSFTFDNVKYSLYDNVYLFKSGESEPYIGKIIKIWQQNQA
KKVKILWFFLPDEIRKHLSGPVMEKEIFLACGEGVGLADINPLEAIGGKC
TVLCISKDERNRQPSPRELAMADYIFYRFFDVNSCTLSEQLPEKIAGVEG
NLLLNSKVE
Ligand information
>7xpk Chain B (length=18) Species: 39947 (Oryza sativa Japonica Group) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PPKRRAISAIRKFPRDCG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7xpk Molecular basis of locus-specific H3K9 methylation catalyzed by SUVH6 in plants.
Resolution1.8 Å
Binding residue
(original residue number in PDB)		F33 D34 Y45 F47 K48 S49 E51 S52 Y55 W75 F76 F77 E81 H85 V103 G104 D107 N109 E112 I114 G115 N151 S152 C153
Binding residue
(residue number reindexed from 1)		F15 D16 Y27 F29 K30 S31 E33 S34 Y37 W57 F58 F59 E63 H67 V85 G86 D89 N91 E94 I96 G97 N133 S134 C135
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003682 chromatin binding

View graph for
Molecular Function
External links
PDB RCSB:7xpk, PDBe:7xpk, PDBj:7xpk
PDBsum7xpk
PubMed36580600
UniProtB9EY07

[Back to BioLiP]