Structure of PDB 7xi4 Chain A Binding Site BS01

Receptor Information
>7xi4 Chain A (length=283) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SSADKERLARENHSEIERRRRNKMTAYITELSDMVPTCSALARKPDKLTI
LRMAVSHMKSLRGTGNKPSFLTDQELKHLILEAADGFLFIVSCETGRVVY
VSDSVTPVLNQPQSEWFGSTLYDQVHPDDVDKLREQLSTSGSRRSFICRM
RCGTSSFVVVHCTGYIKAFCLVAIGRLQVTEFISRHNIEGIFTFVDHRCV
ATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRS
KTREWLWMRTSSFTFQNPYSDEIEYIICTNTNV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7xi4 Structures of NPAS4-ARNT and NPAS4-ARNT2 heterodimers reveal new dimerization modalities in the bHLH-PAS transcription factor family.
Resolution4.707 Å
Binding residue
(original residue number in PDB)		R91 H94 E98 R102 D127 K128
Binding residue
(residue number reindexed from 1)		R10 H13 E17 R21 D46 K47
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0046983 protein dimerization activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005634 nucleus
GO:0005667 transcription regulator complex
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7xi4, PDBe:7xi4, PDBj:7xi4
PDBsum7xi4
PubMed36343253
UniProtP53762|ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator (Gene Name=Arnt)

[Back to BioLiP]