Structure of PDB 7xi3 Chain A Binding Site BS01

Receptor Information
>7xi3 Chain A (length=287) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SKFSRENHSEIERRRRNKMTQYITELSDMVPTCSALARKPDKLTILRMAV
SHMKSMRGKPSFLTEQELKHLILEAADGFLFVVAAETGRVIYVSDSVTPV
LNQPQSEWFGSTLYEQVHPDDVEKLREQLCTSENMGSRRSFICRMRCGNA
QYAVVHCTGYIKAWPGSKYCLVAIGRLQVTSPTEFLSRHNSDGIITFVDP
RCISVIGYQPQDLLGKDILEFCHPEDQSHLRESFQQVVKLKGQVLSVMYR
FRTKNREWLLIRTSSFTFQNPYSDEIEYVTCTNTNVK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7xi3 Structures of NPAS4-ARNT and NPAS4-ARNT2 heterodimers reveal new dimerization modalities in the bHLH-PAS transcription factor family.
Resolution4.274 Å
Binding residue
(original residue number in PDB)		H68 E72 R76 D101 K102
Binding residue
(residue number reindexed from 1)		H8 E12 R16 D41 K42
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0046983 protein dimerization activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005634 nucleus
GO:0005667 transcription regulator complex
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7xi3, PDBe:7xi3, PDBj:7xi3
PDBsum7xi3
PubMed36343253
UniProtQ61324|ARNT2_MOUSE Aryl hydrocarbon receptor nuclear translocator 2 (Gene Name=Arnt2)

[Back to BioLiP]