Structure of PDB 7xfj Chain A Binding Site BS01

Receptor Information
>7xfj Chain A (length=97) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSS
AVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Ligand information
>7xfj Chain I (length=131) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ctgacacgcgcctggagactagggagtaatccccttggcggttaaaacgc
gggggacagcgcgtacgtgcgtttaagcggtgctagagctgtctacgacc
aattgagcggcctcggcaccgggattctcca
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7xfj Structural and mechanistic insights into the DNA glycosylase AAG-mediated base excision in nucleosome.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		H39 Y41 R42 T45 R72 R83 F84 Q85 V117 T118 M120
Binding residue
(residue number reindexed from 1)		H2 Y4 R5 T8 R35 R46 F47 Q48 V80 T81 M83
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:7xfj, PDBe:7xfj, PDBj:7xfj
PDBsum7xfj
PubMed37339965
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]