Structure of PDB 7x9e Chain A Binding Site BS01

Receptor Information
>7x9e Chain A (length=211) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VQLVESGGGVVQPGGSLRLSCEASGFSFKDYGMHWIRQTPGLEWISRISG
DTRGTSYVDSVKGRFIVSRDNSRNSLFLQMNSLRSEDTALYYCAALVIVA
AGDDFDLWGQGTVVTVSSASTKGPSVFPLAPGTAALGCLVKDYFPEPVTV
SWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKP
SNTKVDKKVEP
Ligand information
>7x9e Chain E (length=13) Species: 2697049 (Severe acute respiratory syndrome coronavirus 2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SKRSFIEDLLFNK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7x9e Neutralization mechanism of a human antibody with pan-coronavirus reactivity including SARS-CoV-2.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		R50 L99 V100 V102 A106 D108 F110
Binding residue
(residue number reindexed from 1)		R47 L96 V97 V99 A101 D103 F105
External links