Structure of PDB 7x88 Chain A Binding Site BS01

Receptor Information
>7x88 Chain A (length=139) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QCTVQVRLELGHRAQLRKKPTTEGFTHDWMVFVRGPEQCDIQHFVEKVVF
WLHDSFPKPRRVCKEPPYKVEESGYAGFIMPIEVHFKNKEEPRKVCFTYD
LFLNLEGNLNHLRCEKLTFNNPTTEFRYKLLRAGGVMVM
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7x88 Hotspot mutations in the structured ENL YEATS domain link aberrant transcriptional condensates and cancer.
Resolution2.25 Å
Binding residue
(original residue number in PDB)		H56 S58 F59 G77 Y78 A79 G80 F81 D103 F105
Binding residue
(residue number reindexed from 1)		H53 S55 F56 G74 Y75 A76 G77 F78 D100 F102
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Biological Process
External links
PDB RCSB:7x88, PDBe:7x88, PDBj:7x88
PDBsum7x88
PubMed36272410
UniProtQ03111|ENL_HUMAN Protein ENL (Gene Name=MLLT1)

[Back to BioLiP]