Structure of PDB 7x1c Chain A Binding Site BS01

Receptor Information
>7x1c Chain A (length=277) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTEPRAP
WIEQEGPEYWDGETRNMKASAQTYRENLRIALRYYNQSEAGSHIIQRMYG
CDLGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAA
RVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPVSDHEAT
LRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVP
SGEEQRYTCHVQHEGLPKPLTLRWEPS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7x1c Crystal structure of peptide VSFIEFVI in complex with HLA-B5801
Resolution1.409 Å
Binding residue
(original residue number in PDB)
Y7 Y9 E63 N66 Y74 N77 I80 Y84 R97 Y99 T143 K146 W147 V152 Q155 L156 Y159 W167 Y171
Binding residue
(residue number reindexed from 1)
Y7 Y9 E63 N66 Y74 N77 I80 Y84 R97 Y99 T143 K146 W147 V152 Q155 L156 Y159 W167 Y171
Enzymatic activity
Enzyme Commision number ?
External links