Structure of PDB 7x1b Chain A Binding Site BS01

Receptor Information
>7x1b Chain A (length=277) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTEPRAP
WIEQEGPEYWDGETRNMKASAQTYRENLRIALRYYNQSEAGSHIIQRMYG
CDLGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAA
RVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPVSDHEAT
LRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVP
SGEEQRYTCHVQHEGLPKPLTLRWEPS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7x1b Crystal structure of peptide in complex with HLA-B5801.
Resolution1.399 Å
Binding residue
(original residue number in PDB)
Y7 Y9 E63 N66 S70 T73 Y74 N77 I80 Y84 R97 Y99 T143 K146 W147 Y159 W167 Y171
Binding residue
(residue number reindexed from 1)
Y7 Y9 E63 N66 S70 T73 Y74 N77 I80 Y84 R97 Y99 T143 K146 W147 Y159 W167 Y171
Enzymatic activity
Enzyme Commision number ?
External links