Structure of PDB 7wv3 Chain A Binding Site BS01

Receptor Information

>7wv3 Chain A (length=668) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

TVSHEVADCSHLKLTQVPDDLPTNITVLNLTHNQLRRLPAANFTRYSQLT
SLDVGFNTISKLEPELCQKLPMLKVLNLQHNELSQLSDKTFAFCTNLTEL
HLMSNSIQKIKNNPFVKQKNLITLDLSHNGLSSTKLGTQVQLENLQELLL
SNNKIQALKSEELDIFANSSLKKLELSSNQIKEFSPGCFHAIGRLFGLFL
NNVQLGPSLTEKLCLELANTSIRNLSLSNSQLSTTSNTTFLGLKWTNLTM
LDLSYNNLNVVGNDSFAWLPQLEYFFLEYNNIQHLFSHSLHGLFNVRYLN
LKRSFTKQSISLASLPKIDDFSFQWLKCLEHLNMEDNDIPGIKSNMFTGL
INLKYLSLSNSFTSLRTLTNETFVSLAHSPLHILNLTKNKISKIESDAFS
WLGHLEVLDLGLNEIGQELTGQEWRGLENIFEIYLSYNKYLQLTRNSFAL
VPSLQRLMLRRVALKNVDSSPSPFQPLRNLTILDLSNNNIANINDDMLEG
LEKLEILDLQHNNLARLWKHANPGGPIYFLKGLSHLHILNLESNGFDEIP
VEVFKDLFELKIIDLGLNNLNTLPASVFNNQVSLKSLNLQKNLITSVEKK
VFGPAFRNLTELDMRFNPFDCTCESIAWFVNWINETHTNIPELSSHYLCN
TPPHYHGFPVRLFDTSSC

Ligand information

>7wv3 Chain E (length=80) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

cccccccccccccccccccccccccccccccccccccccccccccccccc
cccccccccccccccccccccccccccccc

..................................................
..............................

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7wv3 TLR3 forms a highly organized cluster when bound to a poly(I:C) RNA ligand.
Resolution	2.26 Å
Binding residue (original residue number in PDB)	N517 H539 N541 G573
Binding residue (residue number reindexed from 1)	N489 H511 N513 G545

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003725	double-stranded RNA binding
GO:0004888	transmembrane signaling receptor activity
GO:0005515	protein binding
GO:0038023	signaling receptor activity
GO:0038187	pattern recognition receptor activity
GO:0042802	identical protein binding
GO:0044389	ubiquitin-like protein ligase binding

	Biological Process
GO:0000165	MAPK cascade
GO:0001774	microglial cell activation
GO:0002224	toll-like receptor signaling pathway
GO:0002730	regulation of dendritic cell cytokine production
GO:0006952	defense response
GO:0006954	inflammatory response
GO:0006955	immune response
GO:0006972	hyperosmotic response
GO:0007165	signal transduction
GO:0007250	activation of NF-kappaB-inducing kinase activity
GO:0007252	I-kappaB phosphorylation
GO:0007254	JNK cascade
GO:0008584	male gonad development
GO:0009597	detection of virus
GO:0009615	response to virus
GO:0010628	positive regulation of gene expression
GO:0032481	positive regulation of type I interferon production
GO:0032722	positive regulation of chemokine production
GO:0032727	positive regulation of interferon-alpha production
GO:0032728	positive regulation of interferon-beta production
GO:0032729	positive regulation of type II interferon production
GO:0032735	positive regulation of interleukin-12 production
GO:0032755	positive regulation of interleukin-6 production
GO:0032757	positive regulation of interleukin-8 production
GO:0032760	positive regulation of tumor necrosis factor production
GO:0034138	toll-like receptor 3 signaling pathway
GO:0034343	type III interferon production
GO:0034346	positive regulation of type III interferon production
GO:0035458	cellular response to interferon-beta
GO:0042742	defense response to bacterium
GO:0043065	positive regulation of apoptotic process
GO:0043123	positive regulation of canonical NF-kappaB signal transduction
GO:0043330	response to exogenous dsRNA
GO:0043331	response to dsRNA
GO:0045087	innate immune response
GO:0045671	negative regulation of osteoclast differentiation
GO:0045766	positive regulation of angiogenesis
GO:0045944	positive regulation of transcription by RNA polymerase II
GO:0046330	positive regulation of JNK cascade
GO:0050729	positive regulation of inflammatory response
GO:0051607	defense response to virus
GO:0060907	positive regulation of macrophage cytokine production
GO:0071260	cellular response to mechanical stimulus
GO:0071346	cellular response to type II interferon
GO:0071360	cellular response to exogenous dsRNA
GO:0071466	cellular response to xenobiotic stimulus
GO:0090594	inflammatory response to wounding
GO:0097191	extrinsic apoptotic signaling pathway
GO:0097527	necroptotic signaling pathway
GO:0098586	cellular response to virus
GO:1900017	positive regulation of cytokine production involved in inflammatory response
GO:1901224	positive regulation of non-canonical NF-kappaB signal transduction

	Cellular Component
GO:0000139	Golgi membrane
GO:0005615	extracellular space
GO:0005737	cytoplasm
GO:0005765	lysosomal membrane
GO:0005768	endosome
GO:0005769	early endosome
GO:0005783	endoplasmic reticulum
GO:0005789	endoplasmic reticulum membrane
GO:0005886	plasma membrane
GO:0009986	cell surface
GO:0010008	endosome membrane
GO:0016020	membrane
GO:0031012	extracellular matrix
GO:0036020	endolysosome membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7wv3, PDBe:7wv3, PDBj:7wv3
PDBsum	7wv3
PubMed	36371424
UniProt	O15455\|TLR3_HUMAN Toll-like receptor 3 (Gene Name=TLR3)

[Back to BioLiP]