Structure of PDB 7wun Chain A Binding Site BS01

Receptor Information
>7wun Chain A (length=70) Species: 39947 (Oryza sativa Japonica Group) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AVCGSVWGQNDLAYRCRTCEHDPTCAICVPCFQNGNHKDHDYSIMYTGGG
CCDCGDTTAWKREGFCSRHK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7wun Crystal structure of UBR box from PRT6
Resolution1.53 Å
Binding residue
(original residue number in PDB)		R134 T143 T166 G168 G169 C170 D172 A178
Binding residue
(residue number reindexed from 1)		R15 T24 T47 G49 G50 C51 D53 A59
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
Gene Ontology
Molecular Function
GO:0008270 zinc ion binding
GO:0061630 ubiquitin protein ligase activity
Biological Process
GO:0071596 ubiquitin-dependent protein catabolic process via the N-end rule pathway

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7wun, PDBe:7wun, PDBj:7wun
PDBsum7wun
PubMed
UniProtA0A0P0UY23

[Back to BioLiP]