Structure of PDB 7wsm Chain A Binding Site BS01

Receptor Information
>7wsm Chain A (length=464) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TGTLVLAVFSAVLGSLQFGYNIGVINAPQKVIEQSYNETWLGRQGPEGPS
SIPPGTLTTLWALSVAIFSVGGMISSFLIGIISQWLGRKRAMLVNNVLAV
LGGSLMGLANAAASYEMLILGRFLIGAYSGLTSGLVPMYVGEIAPTHLRG
ALGTLNQLAIVIGILIAQVLGLESLLGTASLWPLLLGLTVLPALLQLVLL
PFCPESPRYLYIIQNLEGPARKSLKRLTGWADVSGVLAELKDEKRKLERE
RPLSLLQLLGSRTHRQPLIIAVVLQLSQQLSGINAVFYYSTSIFETAGVG
QPAYATIGAGVVNTVFTLVSVLLVERAGRRTLHLLGLAGMCGCAILMTVA
LLLLERVPAMSYVSIVAIFGFVAFFEIGPGPIPWFIVAELFSQGPRPAAM
AVAGFSNWTSNFIIGMGFQYVAEAMGPYVFLLFAVLLLGFFIFTFLRVPE
TRGRTFDQISAAFH
Ligand information
Ligand ID5RH
InChIInChI=1S/C29H37NO5/c1-18-9-7-13-22(31)15-16-25(32)35-29-23(14-8-10-18)27(33)20(3)19(2)26(29)24(30-28(29)34)17-21-11-5-4-6-12-21/h4-6,8,11-12,14-16,18-19,22-24,26-27,31,33H,3,7,9-10,13,17H2,1-2H3,(H,30,34)/b14-8+,16-15+/t18-,19-,22-,23+,24+,26+,27-,29-/m1/s1
InChIKeyGBOGMAARMMDZGR-TYHYBEHESA-N
SMILES
SoftwareSMILES
OpenEye OEToolkits 2.0.4C[C@@H]1CCC[C@H](/C=C/C(=O)O[C@]23[C@@H](/C=C/C1)[C@@H](C(=C)[C@H]([C@H]2[C@@H](NC3=O)Cc4ccccc4)C)O)O
CACTVS 3.385C[C@@H]1CCC[C@@H](O)\C=C\C(=O)O[C@]23[C@@H](/C=C/C1)[C@H](O)C(=C)[C@@H](C)[C@H]2[C@H](Cc4ccccc4)NC3=O
OpenEye OEToolkits 2.0.4CC1CCCC(C=CC(=O)OC23C(C=CC1)C(C(=C)C(C2C(NC3=O)Cc4ccccc4)C)O)O
CACTVS 3.385C[CH]1CCC[CH](O)C=CC(=O)O[C]23[CH](C=CC1)[CH](O)C(=C)[CH](C)[CH]2[CH](Cc4ccccc4)NC3=O
FormulaC29 H37 N O5
NameCytochalasin B
ChEMBLCHEMBL411729
DrugBankDB16766
ZINCZINC000003932776
PDB chain7wsm Chain A Residue 601 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7wsm Cryo-EM structure of human glucose transporter GLUT4.
Resolution3.25 Å
Binding residue
(original residue number in PDB)		S153 Q177 I180 Q298 Q299 F307 W404 N427
Binding residue
(residue number reindexed from 1)		S133 Q157 I160 Q278 Q279 F287 W384 N407
Annotation score1
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0015304 D-glucose uniporter activity
GO:0022857 transmembrane transporter activity
GO:0055056 D-glucose transmembrane transporter activity
Biological Process
GO:0005975 carbohydrate metabolic process
GO:0007611 learning or memory
GO:0007614 short-term memory
GO:0007616 long-term memory
GO:0010021 amylopectin biosynthetic process
GO:0031550 positive regulation of brain-derived neurotrophic factor receptor signaling pathway
GO:0032869 cellular response to insulin stimulus
GO:0042593 glucose homeostasis
GO:0044381 glucose import in response to insulin stimulus
GO:0045471 response to ethanol
GO:0046323 D-glucose import
GO:0050873 brown fat cell differentiation
GO:0055085 transmembrane transport
GO:0070343 white fat cell proliferation
GO:0070837 dehydroascorbic acid transport
GO:0071356 cellular response to tumor necrosis factor
GO:0071456 cellular response to hypoxia
GO:0071470 cellular response to osmotic stress
GO:0098694 regulation of synaptic vesicle budding from presynaptic endocytic zone membrane
GO:0150104 transport across blood-brain barrier
GO:1904659 D-glucose transmembrane transport
Cellular Component
GO:0005737 cytoplasm
GO:0005768 endosome
GO:0005771 multivesicular body
GO:0005802 trans-Golgi network
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0005905 clathrin-coated pit
GO:0009897 external side of plasma membrane
GO:0009986 cell surface
GO:0012505 endomembrane system
GO:0012506 vesicle membrane
GO:0016020 membrane
GO:0016529 sarcoplasmic reticulum
GO:0030136 clathrin-coated vesicle
GO:0030140 trans-Golgi network transport vesicle
GO:0030315 T-tubule
GO:0030659 cytoplasmic vesicle membrane
GO:0031982 vesicle
GO:0032593 insulin-responsive compartment
GO:0042383 sarcolemma
GO:0045121 membrane raft
GO:0048471 perinuclear region of cytoplasm
GO:0070062 extracellular exosome
GO:0098793 presynapse

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7wsm, PDBe:7wsm, PDBj:7wsm
PDBsum7wsm
PubMed35562357
UniProtP14672|GLUT4_HUMAN Solute carrier family 2, facilitated glucose transporter member 4 (Gene Name=SLC2A4)

[Back to BioLiP]