Structure of PDB 7wqq Chain A Binding Site BS01

Receptor Information
>7wqq Chain A (length=228) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TPEVGELIEKVRKAHQETFPALCQLGKYTTRVSLDIDLWDKFSELSTKCI
IKTVEFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTF
SDGLTLNRTQMHHAGFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLIC
GDRQDLEQPDRVDMLQEPLLEALKVYVRKRRPSRPHMFPKMLMKITDLRS
ISAKGAERVITLKMEIPGSMPPLIQEML
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7wqq Effects of breast fibroepithelial tumor associated retinoic acid receptor alpha ligand binding domain mutations on receptor function and retinoid signaling
Resolution1.9 Å
Binding residue
(original residue number in PDB)		V240 K244 I254 K262 E412
Binding residue
(residue number reindexed from 1)		V54 K58 I68 K76 E226
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004879 nuclear receptor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0048384 retinoic acid receptor signaling pathway
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7wqq, PDBe:7wqq, PDBj:7wqq
PDBsum7wqq
PubMed
UniProtP10276|RARA_HUMAN Retinoic acid receptor alpha (Gene Name=RARA)

[Back to BioLiP]