Structure of PDB 7wqg Chain A Binding Site BS01

Receptor Information

>7wqg Chain A (length=121) Species: 9913 (Bos taurus)

EQLTKCEVFRELKDLKGYGGVSLPEWVCTTFHTSGYDTQAIVQNNDSTEY
GLFQINNKIWCKDDQNPHSSNICNISCDKFLDDDLTDDIMCVKKILDKVG
INYWLAHKALCSEKLDQWLCE

Ligand information

• Ligand ID: ZN
• InChI: InChI=1S/Zn/q+2
• InChIKey: PTFCDOFLOPIGGS-UHFFFAOYSA-N
• SMILES:
  CACTVS 3.341: [Zn++]
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Zn+2]
• Formula: Zn
• Name: ZINC ION
• ChEMBL: CHEMBL1236970
• DrugBank: DB14532
• PDB chain: 7wqg Chain A Residue 201

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7wqg Zinc binding strength of proteins dominants zinc uptake in Caco-2 cells.
• Resolution: 2.5 Å
• Binding residue (original residue number in PDB): D82 D84 D88
• Binding residue (residue number reindexed from 1): D82 D84 D88
• Annotation score: 1

Gene Ontology

Molecular Function

• GO:0003796 lysozyme activity
• GO:0004461 lactose synthase activity
• GO:0005509 calcium ion binding
• GO:0042802 identical protein binding
• GO:0046872 metal ion binding

Biological Process

• GO:0005989 lactose biosynthetic process
• GO:0032355 response to estradiol
• GO:0032570 response to progesterone
• GO:1903494 response to dehydroepiandrosterone
• GO:1903496 response to 11-deoxycorticosterone

Cellular Component

• GO:0005576 extracellular region
• GO:0005615 extracellular space

External links

• PDB: RCSB:7wqg, PDBe:7wqg, PDBj:7wqg
• PDBsum: 7wqg
• PubMed: 35975046
• UniProt: P00711|LALBA_BOVIN Alpha-lactalbumin (Gene Name=LALBA)