Structure of PDB 7wnh Chain A Binding Site BS01

Receptor Information
>7wnh Chain A (length=309) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GLCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLANKNCPVDKR
RRNRCQYCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSSLISALVRAHVDS
NPAMTSLDYSRFQANPDDTQHIQQFYDLLTGSMEIIRGWAEKIPGFADLP
KADQDLLFESAFLELFVLRLAYRSNPVEGKLIFCNGVVLHRLQCVRGFGE
WIDSIVEFSSNLQNMNIDISAFSCIAALAMVTERHGLKEPKRVEELQNKI
VNCLKDHVTFNNGGSKLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPAII
DKLFLDTLP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7wnh Integrative analysis reveals structural basis for transcription activation of Nurr1 and Nurr1-RXR alpha heterodimer.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		E281 R312 N313 Q316 R319 R341 R342 G343 R344 L345 P346
Binding residue
(residue number reindexed from 1)		E21 R52 N53 Q56 R59 R81 R82 G83 R84 L85 P86
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0004879 nuclear receptor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7wnh, PDBe:7wnh, PDBj:7wnh
PDBsum7wnh
PubMed36442107
UniProtP43354|NR4A2_HUMAN Nuclear receptor subfamily 4 group A member 2 (Gene Name=NR4A2)

[Back to BioLiP]