Structure of PDB 7wmj Chain A Binding Site BS01

Receptor Information
>7wmj Chain A (length=229) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KPEPTDEEWELIKTVTEAHVATNAQGHWKQKRKFLPDLEAFSHFTKIITP
AITRVVDFAKKLPMFCELPCEDQIILLKGCCMEIMSLRAAVRYDPESETL
TLNGEMAVTRGQLKNGGLGVVSDAIFDLGMSLSSFNLDDTEVALLQAVLL
MSSDRPGLACVERIEKYQDSFLLAFEHYINYRKHHVTHFWPKLLMKVTDL
RMIGACHASRFLHMKCPTELFPPLFLEVF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7wmj Discovery of a Highly Selective and H435R-Sensitive Thyroid Hormone Receptor beta Agonist.
Resolution2.81 Å
Binding residue
(original residue number in PDB)		K288 Q301 I302 L454 E457
Binding residue
(residue number reindexed from 1)		K60 Q73 I74 L224 E227
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004879 nuclear receptor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7wmj, PDBe:7wmj, PDBj:7wmj
PDBsum7wmj
PubMed35507418
UniProtP10828|THB_HUMAN Thyroid hormone receptor beta (Gene Name=THRB)

[Back to BioLiP]