Structure of PDB 7wlp Chain A Binding Site BS01

Receptor Information
>7wlp Chain A (length=182) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHY
NKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSKKAKTRSSR
AGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAA
RDNKKTRIIPRHLQLAIRNDEELNKLLGKVTI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7wlp Epstein-Barr virus protein BKRF4 restricts nucleosome assembly to suppress host antiviral responses.
Resolution2.29 Å
Binding residue
(original residue number in PDB)		S7 I8 Y11 I23 S24 S25 K26 M28 R159
Binding residue
(residue number reindexed from 1)		S5 I6 Y9 I21 S22 S23 K24 M26 R157
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:7wlp, PDBe:7wlp, PDBj:7wlp
PDBsum7wlp
PubMed36067323
UniProtP20671|H2A1D_HUMAN Histone H2A type 1-D (Gene Name=H2AC7);
P23527

[Back to BioLiP]