Structure of PDB 7wl0 Chain A Binding Site BS01

Receptor Information
>7wl0 Chain A (length=214) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EEEARKVKSGIRQMRLFSQDECAKIEARIDEVVSRAEKGLYNEHTVDRAP
LRNKYFFGEGYTYGAQLQKRGPGQERLYPPGDVDEIPEWVHQLVIQKLVE
HRVIPEGFVNSAVINDYQPGGCIVSHVDPIHIFERPIVSVSFFSDSALCF
GCKFQFKPIRVSEPVLSLPVRRGSVTVLSGYAADEITHCIRPQDIKERRA
VIILRKTRLDAPRL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7wl0 Mechanisms of substrate recognition and N6-methyladenosine demethylation revealed by crystal structures of ALKBH5-RNA complexes.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		P128 L129 R130 Y139 G142 P150 E153 I201 V202 S203 H204 V205 D206 P207 F234 I237 T265
Binding residue
(residue number reindexed from 1)		P50 L51 R52 Y61 G64 P72 E75 I123 V124 S125 H126 V127 D128 P129 F156 I159 T187
Enzymatic activity
Enzyme Commision number 1.14.11.53: mRNA N(6)-methyladenine demethylase.
Gene Ontology
Molecular Function
GO:0035515 oxidative RNA demethylase activity
Biological Process
GO:0006397 mRNA processing

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7wl0, PDBe:7wl0, PDBj:7wl0
PDBsum7wl0
PubMed35333330
UniProtQ6P6C2|ALKB5_HUMAN RNA demethylase ALKBH5 (Gene Name=ALKBH5)

[Back to BioLiP]