Structure of PDB 7weg Chain A Binding Site BS01

Receptor Information
>7weg Chain A (length=96) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VSTGALRTITLSKMKQSLGISISGGIESKVQPMVKIEKIFPGGAAFLCGD
LQAGFELVAVDGESLEQVTHQRAVDTIRRAYRNKAREPMELVVRVP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7weg Deafness-related protein PDZD7 forms complex with the C-terminal tail of FCHSD2.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		I870 S871 I872 S873 G874 S878 K879 V880 E887 F890 H920 Q921 R928
Binding residue
(residue number reindexed from 1)		I20 S21 I22 S23 G24 S28 K29 V30 E37 F40 H70 Q71 R78
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7weg, PDBe:7weg, PDBj:7weg
PDBsum7weg
PubMed35695292
UniProtE9Q9W7|PDZD7_MOUSE PDZ domain-containing protein 7 (Gene Name=Pdzd7)

[Back to BioLiP]