Structure of PDB 7wbg Chain A Binding Site BS01

Receptor Information
>7wbg Chain A (length=265) Species: 9031 (Gallus gallus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ELHTLRYISTAMTDPGPGQPWFVDVGYVDGELFTHYNSTARRAVPRTEWI
AANTDQQYWDSETQTSQRSEQIDRDGLGILQRRYNQTGGSHTVQWMYGCD
ILEDGTIRGYRQYAYDGRDFIAFDKGTMTFTAAVPEAVPTKRKWEEGDYA
EGLKQYLEETCVEWLRRYVEYGKAELGRRERPEVRVWGKEADGILTLSCR
AHGFYPRPIAVSWLKDGDAQSGGIVPNGDGTYHTWVTIDAQPGDGDKYQC
RVEHASLPQPGLYSW
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7wbg A Wider and Deeper Peptide-Binding Groove for the Class I Molecules from B15 Compared with B19 Chickens Correlates with Relative Resistance to Marek's Disease.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		Y7 D24 T34 H35 Y58 S61 E62 T65 S66 R68 S69 I72 D73 R83 W95 Y97 R111 Y113 T140 K143 W144 Y149 Y156 W164 Y168
Binding residue
(residue number reindexed from 1)		Y7 D24 T34 H35 Y58 S61 E62 T65 S66 R68 S69 I72 D73 R83 W95 Y97 R111 Y113 T140 K143 W144 Y149 Y156 W164 Y168
Enzymatic activity
Enzyme Commision number ?
External links