Structure of PDB 7w40 Chain A Binding Site BS01

Receptor Information
>7w40 Chain A (length=301) Species: 9606,83333 [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PGILYVIPAVYGVIILIGLIGNITLIKIFCTVKSMRNVPNLFISSLALGD
LLLLITCAPVDASRYLADRWLFGRIGCKLIPFIQLTSVGVSVFTLTALSA
DRYKAIVRPMDIQASHALMKACLKAAFIWIISMLLAIPEAVFSDLHPFHE
ESTNQTFISCAPYPHSNELHPKIHSMASFLVFYVIPLSIISVYYYFIAKN
LIQSAYNLPVEGNIHVKKQIESRKRLAKTVLVFVGLFAFCWLPNHVIYLY
RSYHYSEVDTSMLHFVTSICARLLAFTNSCVNPFALYLLSKSFRKQFNTQ
L
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7w40 Structures of human gastrin-releasing peptide receptors bound to antagonist and agonist for cancer and itch therapy.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		C93 R100 Y101 D104 W106 F184 F193 S195 C196 P198 N280 H281 Y284 R287 V294 F301
Binding residue
(residue number reindexed from 1)		C57 R64 Y65 D68 W70 F148 F157 S159 C160 P162 N244 H245 Y248 R251 V258 F265
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004930 G protein-coupled receptor activity
GO:0005515 protein binding
GO:0015144 carbohydrate transmembrane transporter activity
GO:1901982 maltose binding
Biological Process
GO:0006974 DNA damage response
GO:0007186 G protein-coupled receptor signaling pathway
GO:0008643 carbohydrate transport
GO:0015768 maltose transport
GO:0034219 carbohydrate transmembrane transport
GO:0034289 detection of maltose stimulus
GO:0042956 maltodextrin transmembrane transport
GO:0055085 transmembrane transport
GO:0060326 cell chemotaxis
Cellular Component
GO:0016020 membrane
GO:0030288 outer membrane-bounded periplasmic space
GO:0042597 periplasmic space
GO:0043190 ATP-binding cassette (ABC) transporter complex
GO:0055052 ATP-binding cassette (ABC) transporter complex, substrate-binding subunit-containing
GO:1990060 maltose transport complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7w40, PDBe:7w40, PDBj:7w40
PDBsum7w40
PubMed36724251
UniProtP0AEX9|MALE_ECOLI Maltose/maltodextrin-binding periplasmic protein (Gene Name=malE);
P30550|GRPR_HUMAN Gastrin-releasing peptide receptor (Gene Name=GRPR)

[Back to BioLiP]