Structure of PDB 7w3z Chain A Binding Site BS01

Receptor Information
>7w3z Chain A (length=301) Species: 9606,83333 [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PGILYVIPAVYGVIILIGLIGNITLIKIFCTVKSMRNVPNLFISSLALGD
LLLLITCAPVDASRYLADRWLFGRIGCKLIPFIQLTSVGVSVFTLTALSA
DRYKAIVRPMDIQASHALMKACLKAAFIWIISMLLAIPEAVFSDLHPFHE
ESTNQTFISCAPYPHSNELHPKIHSMASFLVFYVIPLSIISVYYYFIAKN
LIQSAYNLPVEGNIHVKKQIESRKRLAKTVLVFVGLFAFCWLPNHVIYLY
RSYHYSEVDTSMLHFVTSICARLLAFTNSCVNPFALYLLSKSFRKQFNTQ
L
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7w3z Structures of human gastrin-releasing peptide receptors bound to antagonist and agonist for cancer and itch therapy.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		L89 C93 R100 Y101 D104 R105 W106 P117 Q120 E175 F184 E186 Q191 F193 S195 P198 W277 N280 Y284 R287 T296 F301 R308 F312
Binding residue
(residue number reindexed from 1)		L53 C57 R64 Y65 D68 R69 W70 P81 Q84 E139 F148 E150 Q155 F157 S159 P162 W241 N244 Y248 R251 T260 F265 R272 F276
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004930 G protein-coupled receptor activity
GO:0005515 protein binding
GO:0015144 carbohydrate transmembrane transporter activity
GO:1901982 maltose binding
Biological Process
GO:0006974 DNA damage response
GO:0007186 G protein-coupled receptor signaling pathway
GO:0008643 carbohydrate transport
GO:0015768 maltose transport
GO:0034219 carbohydrate transmembrane transport
GO:0034289 detection of maltose stimulus
GO:0042956 maltodextrin transmembrane transport
GO:0055085 transmembrane transport
GO:0060326 cell chemotaxis
Cellular Component
GO:0016020 membrane
GO:0030288 outer membrane-bounded periplasmic space
GO:0042597 periplasmic space
GO:0043190 ATP-binding cassette (ABC) transporter complex
GO:0055052 ATP-binding cassette (ABC) transporter complex, substrate-binding subunit-containing
GO:1990060 maltose transport complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7w3z, PDBe:7w3z, PDBj:7w3z
PDBsum7w3z
PubMed36724251
UniProtP0AEX9|MALE_ECOLI Maltose/maltodextrin-binding periplasmic protein (Gene Name=malE);
P30550|GRPR_HUMAN Gastrin-releasing peptide receptor (Gene Name=GRPR)

[Back to BioLiP]