Structure of PDB 7vze Chain A Binding Site BS01

Receptor Information
>7vze Chain A (length=89) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LVLIRMKPDENGRFGFNVKGGYDQKMPVIVSRVAPGTPADLCVPRLNEGD
QVVLINGRDIAEHTHDQVVLFIKASCERHSGELMLLVRP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7vze Structural and biochemical analysis of the PTPN4 PDZ domain bound to the C-terminal tail of the human papillomavirus E6 oncoprotein.
Resolution2.882 Å
Binding residue
(original residue number in PDB)
R527 F528 G529 F530 N531 V532 K533 Q538 H579 D580
Binding residue
(residue number reindexed from 1)
R13 F14 G15 F16 N17 V18 K19 Q24 H65 D66
Enzymatic activity
Enzyme Commision number 3.1.3.48: protein-tyrosine-phosphatase.
External links
PDB RCSB:7vze, PDBe:7vze, PDBj:7vze
PDBsum7vze
PubMed35089587
UniProtP29074|PTN4_HUMAN Tyrosine-protein phosphatase non-receptor type 4 (Gene Name=PTPN4)

[Back to BioLiP]