Structure of PDB 7vyw Chain A Binding Site BS01

Receptor Information

>7vyw Chain A (length=47) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GGFYEIEAIRRKRVRKGKVQYLIKWRGWPETANTWEPLENLQSIADV

Ligand information

>7vyw Chain B (length=6) Species: 3702 (Arabidopsis thaliana) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

PTARKS

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7vyw Structural basis for the recognition of methylated histone H3 by the Arabidopsis LHP1 chromodomain.
Resolution	1.6 Å
Binding residue (original residue number in PDB)	G105 G106 F107 Y108 E109 I110 W129 W132 E140 N144
Binding residue (residue number reindexed from 1)	G1 G2 F3 Y4 E5 I6 W25 W28 E36 N40

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0006325	chromatin organization
GO:0031507	heterochromatin formation

View graph for
Biological Process

External links

PDB	RCSB:7vyw, PDBe:7vyw, PDBj:7vyw
PDBsum	7vyw
PubMed	35074427
UniProt	Q946J8\|LHP1_ARATH Chromo domain-containing protein LHP1 (Gene Name=LHP1)

[Back to BioLiP]