Structure of PDB 7vrf Chain A Binding Site BS01

Receptor Information
>7vrf Chain A (length=61) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SSEYIVEKFLGKRYLRGRPQYLTKWEGYPIEQCTWEPLENLGKCMTLIAD
YEAELFQQSRE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7vrf Structural insights into the chromodomain of Oxpecker in complex with histone H3 lysine 9 trimethylation reveal a transposon silencing mechanism by heterodimerization.
Resolution1.7 Å
Binding residue
(original residue number in PDB)		S20 E21 Y22 I23 W43 Y46 Q50 E54 K61 C62 L65
Binding residue
(residue number reindexed from 1)		S2 E3 Y4 I5 W25 Y28 Q32 E36 K43 C44 L47
Enzymatic activity
Enzyme Commision number ?
External links