Structure of PDB 7vkl Chain A Binding Site BS01

Receptor Information
>7vkl Chain A (length=160) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KPCDLPLRLLVPTQFVGAIIGKEGATIRNITKQTQSKIDVHRKEAAEKSI
TILSTPEGTSAACKSILEIMHKEAQDIKFTEEIPLKILAHNNFVGRLIGK
EGRNLKKIEQDTDTKITISPLQELTLYNPERTITVKGSVETCAKAEEEIM
KKIRESYEND
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7vkl Crystal structure of MmIMP3-KH12 in complex with zipcode RNA
Resolution1.95 Å
Binding residue
(original residue number in PDB)		V207 G208 I211 G212 K213 E214 G215 I218 I229 D230 V231 R233 K242 E267
Binding residue
(residue number reindexed from 1)		V16 G17 I20 G21 K22 E23 G24 I27 I38 D39 V40 R42 K48 E73
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:7vkl, PDBe:7vkl, PDBj:7vkl
PDBsum7vkl
PubMed
UniProtQ9CPN8|IF2B3_MOUSE Insulin-like growth factor 2 mRNA-binding protein 3 (Gene Name=Igf2bp3)

[Back to BioLiP]