Structure of PDB 7vg8 Chain A Binding Site BS01

Receptor Information
>7vg8 Chain A (length=108) Species: 10832 (Tomato yellow leaf curl virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FKIYAKNYFLTYPNCSLSKEEALSQLKNLETPTNKKYIKVCRELHENGEP
HLHVLIQFEGKYQCKNQRFFDLVSAHFHPNIQAAKSSTDVKTFVEKDGDF
IDFGVFQI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7vg8 structure of TYLCV Rep complexed with ssDNA
Resolution2.04 Å
Binding residue
(original residue number in PDB)		F5 K6 I7 F13 T15 P17 N18 H49 E50 H57 Q71 R72 H86 P87 N88 I89 Q90 K93 S94 V98 F101
Binding residue
(residue number reindexed from 1)		F1 K2 I3 F9 T11 P13 N14 H45 E46 H53 Q67 R68 H78 P79 N80 I81 Q82 K85 S86 V90 F93
Enzymatic activity
Enzyme Commision number 3.1.21.-
Gene Ontology
Molecular Function
GO:0005198 structural molecule activity
Biological Process
GO:0006260 DNA replication

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7vg8, PDBe:7vg8, PDBj:7vg8
PDBsum7vg8
PubMed
UniProtH6WA92

[Back to BioLiP]