Structure of PDB 7vcq Chain A Binding Site BS01

Receptor Information
>7vcq Chain A (length=75) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNL
CAIHAKRVTIMPKDIQLARRIRGER
Ligand information
>7vcq Chain K (length=19) Species: 82830 (Epstein-barr virus strain ag876) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
EEIDLEEEDESDYSESDED
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7vcq Epstein-Barr Virus Tegument Protein BKRF4 is a Histone Chaperone.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		R69 T118
Binding residue
(residue number reindexed from 1)		R10 T59
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:7vcq, PDBe:7vcq, PDBj:7vcq
PDBsum7vcq
PubMed35870648
UniProtP84243|H33_HUMAN Histone H3.3 (Gene Name=H3-3A)

[Back to BioLiP]