Structure of PDB 7va6 Chain A Binding Site BS01

Receptor Information

>7va6 Chain A (length=176) Species: 208964 (Pseudomonas aeruginosa PAO1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MQNPQNLIWIALEMTGLDPDRDVIIEMATIVTDSDLNTLAEGPVIAIHQP
EEILAGMDEWNTRQHGQSGLTQRVRESTVSMAEAEAQTLAFLEQWVPKRS
SPICGNSICQDRRFLYRHMPRLEGYFHYRNLDVSTLKELAARWAPQVRES
FTHLALDDIRESIAELRHYRDHFIKL

Ligand information

>7va6 Chain C (length=2) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7va6 PaOrn Oligoribonuclease D11A mutant with RNA GU complex structure
Resolution	2.1 Å
Binding residue (original residue number in PDB)	E13 M14 L17 W60 N61 H65 N106 S107 Q110 S134
Binding residue (residue number reindexed from 1)	E13 M14 L17 W60 N61 H65 N106 S107 Q110 S134

Enzymatic activity

Enzyme Commision number

3.1.15.-

Gene Ontology

	Molecular Function
GO:0000175	3'-5'-RNA exonuclease activity
GO:0003676	nucleic acid binding
GO:0004527	exonuclease activity
GO:0016896	RNA exonuclease activity, producing 5'-phosphomonoesters

	Biological Process
GO:0006259	DNA metabolic process

	Cellular Component
GO:0005737	cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7va6, PDBe:7va6, PDBj:7va6
PDBsum	7va6
PubMed
UniProt	P57665\|ORN_PSEAE Oligoribonuclease (Gene Name=orn)

[Back to BioLiP]