Structure of PDB 7v9f Chain A Binding Site BS01

Receptor Information
>7v9f Chain A (length=107) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VPSPYLLSDKEVREIVQQSLSVGNFAARMLVRLFPELFTTENLRLQYNHS
GACNKKQLDPTRLRLIRHYVEAVYPVEKMEEVWHYECIPSIDERCRRPNR
KKCDILK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7v9f Highly enriched BEND3 prevents the premature activation of bivalent genes during differentiation.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		L731 S732 N735 R739
Binding residue
(residue number reindexed from 1)		L20 S21 N24 R28
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0000183 rDNA heterochromatin formation
Cellular Component
GO:0000792 heterochromatin

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7v9f, PDBe:7v9f, PDBj:7v9f
PDBsum7v9f
PubMed35143257
UniProtQ6PAL0|BEND3_MOUSE BEN domain-containing protein 3 (Gene Name=Bend3)

[Back to BioLiP]