Structure of PDB 7v6w Chain A Binding Site BS01

Receptor Information
>7v6w Chain A (length=58) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MIITSPTEARKDFYQLLKNVNNNHEPIYISGNNAENNAVIIGLEDWKSIQ
ETIYLEST
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7v6w The two paralogous copies of the YoeB-YefM toxin-antitoxin module in Staphylococcus aureus differ in DNA binding and recognition patterns.
Resolution2.55 Å
Binding residue
(original residue number in PDB)
Y14 K18 N32
Binding residue
(residue number reindexed from 1)
Y14 K18 N32
Enzymatic activity
Enzyme Commision number ?
External links