Structure of PDB 7uzz Chain A Binding Site BS01

Receptor Information
>7uzz Chain A (length=205) Species: 176279 (Staphylococcus epidermidis RP62A) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YSKIKISGTIEVVTGLHIGGGGDSPVVRDLQTKLPIIPGSSIKGKMRNLL
AKHFGLKMKQESHNQDDERVLRLFGSSEKGNIQRARLQISDAFFSEKTKE
HFAQNDIAYTETKFENTINRLTAVANPRQIERVTRGSEFDFVFIYNVDEE
SQVEDDFENIEKAIHLLENDYLGGGGTRGNGRIQFKDTNIETVVGEYDST
NLKIK
Ligand information
>7uzz Chain G (length=30) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
acgagaacacguaugccgaaguauauaaau
..............................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7uzz Structures of an active type III-A CRISPR effector complex.
Resolution4.45 Å
Binding residue
(original residue number in PDB)		H18 I19 G20 P47 S49 K52 G53 K54 R56 G84 S85 S86 E87 E124 N125 T126 I127 A134 P136 R137 Y180 G182 G183 T186 R187
Binding residue
(residue number reindexed from 1)		H17 I18 G19 P38 S40 K43 G44 K45 R47 G75 S76 S77 E78 E115 N116 T117 I118 A125 P127 R128 Y171 G173 G174 T177 R178
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0004519 endonuclease activity
GO:0046872 metal ion binding
Biological Process
GO:0051607 defense response to virus

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7uzz, PDBe:7uzz, PDBj:7uzz
PDBsum7uzz
PubMed35714601
UniProtQ5HK91

[Back to BioLiP]