Structure of PDB 7uzx Chain A Binding Site BS01

Receptor Information
>7uzx Chain A (length=204) Species: 176279 (Staphylococcus epidermidis RP62A) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YSKIKISGTIEVVTGLHIGGGGSPVVRDLQTKLPIIPGSSIKGKMRNLLA
KHFGLKMKQESHNQDDERVLRLFGSSEKGNIQRARLQISDAFFSEKTKEH
FAQNDIAYTETKFENTINRLTAVANPRQIERVTRGSEFDFVFIYNVDEES
QVEDDFENIEKAIHLLENDYLGGGGTRGNGRIQFKDTNIETVVGEYDSTN
LKIK
Ligand information
>7uzx Chain G (length=31) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
acgagaacuaguaauaauugucauuugcaua
...............................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7uzx Structures of an active type III-A CRISPR effector complex.
Resolution3.49 Å
Binding residue
(original residue number in PDB)		I19 G20 G21 G23 P47 S49 S50 K52 G53 R56 S85 S86 E87 N125 T126 I127 P136 R137 Y180 G183 T186 R187
Binding residue
(residue number reindexed from 1)		I18 G19 G20 G22 P37 S39 S40 K42 G43 R46 S75 S76 E77 N115 T116 I117 P126 R127 Y170 G173 T176 R177
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0004519 endonuclease activity
GO:0046872 metal ion binding
Biological Process
GO:0051607 defense response to virus

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7uzx, PDBe:7uzx, PDBj:7uzx
PDBsum7uzx
PubMed35714601
UniProtQ5HK91

[Back to BioLiP]