Structure of PDB 7uyk Chain A Binding Site BS01

Receptor Information
>7uyk Chain A (length=140) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EGLQLVSMIREGEAAGACPEEIFSALQYSGTEVPLQWLRSELPYVLEMVA
ELAGQQDPGLGAFSCQEARRAWLDRHGNLDEAVEECVRTRRRKVQELQSL
GFGPEEGSLQALFQHGGDVSRALTELQRQRLEPFRQRLWD
Ligand information
>7uyk Chain C (length=17) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DPAMQRCFSAAVYCAIS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7uyk De novo mapping of alpha-helix recognition sites on protein surfaces using unbiased libraries.
Resolution2.7 Å
Binding residue
(original residue number in PDB)		P505 E506 E507 F509 L524 R525 V531 M534 W558 H562 G563 L565 D566
Binding residue
(residue number reindexed from 1)		P19 E20 E21 F23 L38 R39 V45 M48 W72 H76 G77 L79 D80
Enzymatic activity
Enzyme Commision number 2.3.2.31: RBR-type E3 ubiquitin transferase.
Gene Ontology
Molecular Function
GO:0004842 ubiquitin-protein transferase activity
Cellular Component
GO:0071797 LUBAC complex

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:7uyk, PDBe:7uyk, PDBj:7uyk
PDBsum7uyk
PubMed36534810
UniProtQ96EP0|RNF31_HUMAN E3 ubiquitin-protein ligase RNF31 (Gene Name=RNF31)

[Back to BioLiP]