Structure of PDB 7uyj Chain A Binding Site BS01

Receptor Information
>7uyj Chain A (length=175) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GEEEERAFLVAREELASALRRDSGQAFSLEQLRPLLASSLPLAARYLQLD
AARLVRCNAHGEPRNYLNTLSTALNILEKYGRNLLSPQRPRYWRGVKFNN
PVFRSTVDAVQGGRDVLRLYGYTEEQPDGLSFPEGQEEPDEHQVATVTLE
VLLLRTELSLLLQNTHPRQQALEQL
Ligand information
>7uyj Chain C (length=17) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DPAIVQCAWAALYCDMQ
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7uyj De novo mapping of alpha-helix recognition sites on protein surfaces using unbiased libraries.
Resolution2.32 Å
Binding residue
(original residue number in PDB)		N77 I78 K81 Y82 N85 P92 Y94 N102 V104 F105
Binding residue
(residue number reindexed from 1)		N75 I76 K79 Y80 N83 P90 Y92 N100 V102 F103
Enzymatic activity
Enzyme Commision number 2.3.2.31: RBR-type E3 ubiquitin transferase.
Gene Ontology
Molecular Function
GO:0004842 ubiquitin-protein transferase activity
Cellular Component
GO:0071797 LUBAC complex

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:7uyj, PDBe:7uyj, PDBj:7uyj
PDBsum7uyj
PubMed36534810
UniProtQ96EP0|RNF31_HUMAN E3 ubiquitin-protein ligase RNF31 (Gene Name=RNF31)

[Back to BioLiP]