Structure of PDB 7uy8 Chain A Binding Site BS01

Receptor Information

>7uy8 Chain A (length=156) Species: 5911 (Tetrahymena thermophila)

SKRNQFLTSIPRVLVDCKKCDQTFLFLGADAASILKCKCGNDIYIQLKNK
IALVVKELIRNFEENAIQIDNEEFEYTHQISLVGKAKQQKMSSFTLNQKL
LSIQAMFDITKEEQENTQKVTIEKIKTIKKTLDDLLSKSQYNNLNLSNIF
TSFGLL

Ligand information

• Ligand ID: ZN
• InChI: InChI=1S/Zn/q+2
• InChIKey: PTFCDOFLOPIGGS-UHFFFAOYSA-N
• SMILES:
  CACTVS 3.341: [Zn++]
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Zn+2]
• Formula: Zn
• Name: ZINC ION
• ChEMBL: CHEMBL1236970
• DrugBank: DB14532
• PDB chain: 7uy8 Chain A Residue 1401

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7uy8 Structure of Tetrahymena telomerase-bound CST with polymerase alpha-primase.
• Resolution: 4.5 Å
• Binding residue (original residue number in PDB): C1248 C1273 C1275
• Binding residue (residue number reindexed from 1): C17 C37 C39
• Annotation score: 1

Enzymatic activity

• Enzyme Commision number: 2.7.7.7: DNA-directed DNA polymerase.

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0003676 nucleic acid binding
• GO:0003677 DNA binding
• GO:0003682 chromatin binding
• GO:0003688 DNA replication origin binding
• GO:0003697 single-stranded DNA binding
• GO:0003887 DNA-directed DNA polymerase activity

Biological Process

• GO:0006259 DNA metabolic process
• GO:0006260 DNA replication
• GO:0006272 leading strand elongation
• GO:0006273 lagging strand elongation
• GO:0071897 DNA biosynthetic process
• GO:1902975 mitotic DNA replication initiation

Cellular Component

• GO:0005634 nucleus
• GO:0005658 alpha DNA polymerase:primase complex

External links

• PDB: RCSB:7uy8, PDBe:7uy8, PDBj:7uy8
• PDBsum: 7uy8
• PubMed: 35831498
• UniProt: Q23AJ0