Structure of PDB 7uy2 Chain A Binding Site BS01

Receptor Information
>7uy2 Chain A (length=175) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GEEEERAFLVAREELASALRRDSGQAFSLEQLRPLLASSLPLAARYLQLD
AARLVRCNAHGEPRNYLNTLSTALNILEKYGRNLLSPQRPRYWRGVKFNN
PVFRSTVDAVQGGRDVLRLYGYTEEQPDGLSFPEGQEEPDEHQVATVTLE
VLLLRTELSLLLQNTHPRQQALEQL
Ligand information
>7uy2 Chain C (length=14) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
FTDCQLAAAVCMTY
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7uy2 De novo mapping of alpha-helix recognition sites on protein surfaces using unbiased libraries.
Resolution2.51 Å
Binding residue
(original residue number in PDB)
K81 Y82 N85 P92 Y94 G97 V98 K99 V104
Binding residue
(residue number reindexed from 1)
K79 Y80 N83 P90 Y92 G95 V96 K97 V102
Enzymatic activity
Enzyme Commision number 2.3.2.31: RBR-type E3 ubiquitin transferase.
Gene Ontology
Molecular Function
GO:0004842 ubiquitin-protein transferase activity
Cellular Component
GO:0071797 LUBAC complex

View graph for
Molecular Function

View graph for
Cellular Component
External links
PDB RCSB:7uy2, PDBe:7uy2, PDBj:7uy2
PDBsum7uy2
PubMed36534810
UniProtQ96EP0|RNF31_HUMAN E3 ubiquitin-protein ligase RNF31 (Gene Name=RNF31)

[Back to BioLiP]