Structure of PDB 7uxo Chain A Binding Site BS01

Receptor Information
>7uxo Chain A (length=121) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQF
VHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMIS
YGGADYKRITVKVNAPYAAAL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7uxo De novo mapping of alpha-helix recognition sites on protein surfaces using unbiased libraries.
Resolution2.25 Å
Binding residue
(original residue number in PDB)
Y56 R113 M115 S117 G120 A121 D122 Y123 R125
Binding residue
(residue number reindexed from 1)
Y39 R96 M98 S100 G103 A104 D105 Y106 R108
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7uxo, PDBe:7uxo, PDBj:7uxo
PDBsum7uxo
PubMed36534810
UniProtQ9NZQ7|PD1L1_HUMAN Programmed cell death 1 ligand 1 (Gene Name=CD274)

[Back to BioLiP]