Structure of PDB 7uxd Chain A Binding Site BS01

Receptor Information
>7uxd Chain A (length=190) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RHSMDPATFTFNFNNEPWVRGRHETYLCYEVERMHNDTWVKLAQRRGFLA
NQAKHKHGFLEGRHAELCFLDVIPFWKLDLDQDYRVTCFTSWSPCFSCAQ
EMAKFISKNKHVSLCIKTARIYDDKGRAAEGLRTLAEAGAKISIMTYSEF
KHCWDTFVDHQGAPFQPWDGLDEHSQDLSGRLRAILQNQE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7uxd Structure of the catalytically active APOBEC3G bound to a DNA oligonucleotide inhibitor reveals tetrahedral geometry of the transition state.
Resolution1.5 Å
Binding residue
(original residue number in PDB)		W211 V212 R213 H216 T218 N244 K247 H248 H257 E259 W285 C288 Y315 D316 D317 K318
Binding residue
(residue number reindexed from 1)		W18 V19 R20 H23 T25 N51 K54 H55 H64 E66 W92 C95 Y122 D123 D124 K125
Enzymatic activity
Enzyme Commision number 3.5.4.38: single-stranded DNA cytosine deaminase.
Gene Ontology
Molecular Function
GO:0003824 catalytic activity
GO:0008270 zinc ion binding
GO:0016787 hydrolase activity

View graph for
Molecular Function
External links
PDB RCSB:7uxd, PDBe:7uxd, PDBj:7uxd
PDBsum7uxd
PubMed36402773
UniProtQ9HC16|ABC3G_HUMAN DNA dC->dU-editing enzyme APOBEC-3G (Gene Name=APOBEC3G)

[Back to BioLiP]