Structure of PDB 7uqy Chain A Binding Site BS01

Receptor Information
>7uqy Chain A (length=582) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SSIYKGKKCRMESCFDFTLCKKNGFKVYVYPQQKGEKIAESYQNILAAIE
GSRFYTSDPSQACLFVLSLDTLDRDQLSPQYVHNLRSKVQSLHLWNNGRN
HLIFNLYSGTWPDYTEDVGFDIGQAMLAKASISTENFRPNFDVSIPLFSK
DHPRTGGERGFLKFNTIPPLRKYMLVFKGKRYLTGIGSDTRNALYHVHNG
EDVVLLTTCKHGKDWQKHKDSRCDRDNTEYEKYDYREMLHNATFCLVPRG
RRLGSFRFLEALQAACVPVMLSNGWELPFSEVINWNQAAVIGDERLLLQI
PSTIRSIHQDKILALRQQTQFLWEAYFSSVEKIVLTTLEIIQDRIFKHIS
RNSLIWNKHPGGLFVLPQYSSYLGDFPYYYANLGLKPPSKFTAVIHAVQP
VLKLLVAAAKSQYCAQIIVLWNSSRFLPYDNIITDAVLSLDEDTVLSTTE
VDFAFTVWQSFPERIVGYPARSHFWDNSKERWGYTSKWTNDYSMVLTGAA
IYHKYYHYLYSHYLPASLKNMVDQLANCEDILMNFLVSAVTKLPPIKVTQ
DHFAQRQSCMNTFASWFGYMPLIHSQMRLDPV
Ligand information
Ligand IDUDP
InChIInChI=1S/C9H14N2O12P2/c12-5-1-2-11(9(15)10-5)8-7(14)6(13)4(22-8)3-21-25(19,20)23-24(16,17)18/h1-2,4,6-8,13-14H,3H2,(H,19,20)(H,10,12,15)(H2,16,17,18)/t4-,6-,7-,8-/m1/s1
InChIKeyXCCTYIAWTASOJW-XVFCMESISA-N
SMILES
SoftwareSMILES
OpenEye OEToolkits 1.7.0C1=CN(C(=O)NC1=O)[C@H]2[C@@H]([C@@H]([C@H](O2)CO[P@@](=O)(O)OP(=O)(O)O)O)O
CACTVS 3.370O[CH]1[CH](O)[CH](O[CH]1CO[P](O)(=O)O[P](O)(O)=O)N2C=CC(=O)NC2=O
CACTVS 3.370O[C@H]1[C@@H](O)[C@@H](O[C@@H]1CO[P](O)(=O)O[P](O)(O)=O)N2C=CC(=O)NC2=O
OpenEye OEToolkits 1.7.0C1=CN(C(=O)NC1=O)C2C(C(C(O2)COP(=O)(O)OP(=O)(O)O)O)O
ACDLabs 12.01O=P(O)(O)OP(=O)(O)OCC2OC(N1C(=O)NC(=O)C=C1)C(O)C2O
FormulaC9 H14 N2 O12 P2
NameURIDINE-5'-DIPHOSPHATE
ChEMBLCHEMBL130266
DrugBankDB03435
ZINCZINC000004490939
PDB chain7uqy Chain A Residue 801 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7uqy Structural basis for heparan sulfate co-polymerase action by the EXT1-2 complex.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		K267 K269 Y271 R280 Y324 R346 E349
Binding residue
(residue number reindexed from 1)		K178 K180 Y182 R191 Y235 R257 E260
Annotation score3
Enzymatic activity
Enzyme Commision number 2.4.1.225: N-acetylglucosaminyl-proteoglycan 4-beta-glucuronosyltransferase.
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0008375 acetylglucosaminyltransferase activity
GO:0015020 glucuronosyltransferase activity
GO:0016757 glycosyltransferase activity
GO:0042328 heparan sulfate N-acetylglucosaminyltransferase activity
GO:0042803 protein homodimerization activity
GO:0046872 metal ion binding
GO:0046982 protein heterodimerization activity
GO:0050508 glucuronosyl-N-acetylglucosaminyl-proteoglycan 4-alpha-N-acetylglucosaminyltransferase activity
GO:0050509 N-acetylglucosaminyl-proteoglycan 4-beta-glucuronosyltransferase activity
Biological Process
GO:0000271 polysaccharide biosynthetic process
GO:0000902 cell morphogenesis
GO:0001503 ossification
GO:0001958 endochondral ossification
GO:0001974 blood vessel remodeling
GO:0002062 chondrocyte differentiation
GO:0002067 glandular epithelial cell differentiation
GO:0002244 hematopoietic progenitor cell differentiation
GO:0002524 hypersensitivity
GO:0003128 heart field specification
GO:0003415 chondrocyte hypertrophy
GO:0003416 endochondral bone growth
GO:0006024 glycosaminoglycan biosynthetic process
GO:0006486 protein glycosylation
GO:0007033 vacuole organization
GO:0007155 cell adhesion
GO:0007166 cell surface receptor signaling pathway
GO:0007224 smoothened signaling pathway
GO:0007369 gastrulation
GO:0007411 axon guidance
GO:0007420 brain development
GO:0007492 endoderm development
GO:0007498 mesoderm development
GO:0008217 regulation of blood pressure
GO:0008283 cell population proliferation
GO:0008543 fibroblast growth factor receptor signaling pathway
GO:0009615 response to virus
GO:0009642 response to light intensity
GO:0010467 gene expression
GO:0010803 regulation of tumor necrosis factor-mediated signaling pathway
GO:0014033 neural crest cell differentiation
GO:0015012 heparan sulfate proteoglycan biosynthetic process
GO:0015014 heparan sulfate proteoglycan biosynthetic process, polysaccharide chain biosynthetic process
GO:0017145 stem cell division
GO:0019882 antigen processing and presentation
GO:0021554 optic nerve development
GO:0021772 olfactory bulb development
GO:0022405 hair cycle process
GO:0030163 protein catabolic process
GO:0030166 proteoglycan biosynthetic process
GO:0030199 collagen fibril organization
GO:0030202 heparin metabolic process
GO:0030204 chondroitin sulfate metabolic process
GO:0030210 heparin biosynthetic process
GO:0030509 BMP signaling pathway
GO:0031069 hair follicle morphogenesis
GO:0031175 neuron projection development
GO:0032836 glomerular basement membrane development
GO:0033627 cell adhesion mediated by integrin
GO:0035176 social behavior
GO:0035249 synaptic transmission, glutamatergic
GO:0035264 multicellular organism growth
GO:0035988 chondrocyte proliferation
GO:0036022 limb joint morphogenesis
GO:0036336 dendritic cell migration
GO:0036339 lymphocyte adhesion to endothelial cell of high endothelial venule
GO:0042044 fluid transport
GO:0042060 wound healing
GO:0042311 vasodilation
GO:0042596 fear response
GO:0043931 ossification involved in bone maturation
GO:0044344 cellular response to fibroblast growth factor stimulus
GO:0045165 cell fate commitment
GO:0045453 bone resorption
GO:0048598 embryonic morphogenesis
GO:0048733 sebaceous gland development
GO:0050891 multicellular organismal-level water homeostasis
GO:0050901 leukocyte tethering or rolling
GO:0051923 sulfation
GO:0055078 sodium ion homeostasis
GO:0060047 heart contraction
GO:0060070 canonical Wnt signaling pathway
GO:0060218 hematopoietic stem cell differentiation
GO:0060349 bone morphogenesis
GO:0060350 endochondral bone morphogenesis
GO:0060351 cartilage development involved in endochondral bone morphogenesis
GO:0060429 epithelium development
GO:0060441 epithelial tube branching involved in lung morphogenesis
GO:0060485 mesenchyme development
GO:0060506 smoothened signaling pathway involved in lung development
GO:0060560 developmental growth involved in morphogenesis
GO:0060792 sweat gland development
GO:0061484 hematopoietic stem cell homeostasis
GO:0061744 motor behavior
GO:0061974 perichondral bone morphogenesis
GO:0062094 stomach development
GO:0065003 protein-containing complex assembly
GO:0070593 dendrite self-avoidance
GO:0070848 response to growth factor
GO:0071503 response to heparin
GO:0071625 vocalization behavior
GO:0071711 basement membrane organization
GO:0071773 cellular response to BMP stimulus
GO:0072112 podocyte differentiation
GO:0072498 embryonic skeletal joint development
GO:0097021 lymphocyte migration into lymphoid organs
GO:0097241 hematopoietic stem cell migration to bone marrow
GO:0098586 cellular response to virus
GO:0098868 bone growth
GO:0120193 tight junction organization
GO:1901706 mesenchymal cell differentiation involved in bone development
GO:1904888 cranial skeletal system development
GO:1990823 response to leukemia inhibitory factor
Cellular Component
GO:0000139 Golgi membrane
GO:0005783 endoplasmic reticulum
GO:0005789 endoplasmic reticulum membrane
GO:0005794 Golgi apparatus
GO:0016020 membrane
GO:0045202 synapse
GO:1902494 catalytic complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7uqy, PDBe:7uqy, PDBj:7uqy
PDBsum7uqy
PubMed36593275
UniProtQ16394|EXT1_HUMAN Exostosin-1 (Gene Name=EXT1)

[Back to BioLiP]