Structure of PDB 7uqn Chain A Binding Site BS01

Receptor Information
>7uqn Chain A (length=148) Species: 3469 (Papaver somniferum) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GLVGKLVTQLEVNCDADIFYKIVKHHEPNVIPHFFTGVQVTKGDGLVSGC
IKEWNYVLEGKAMTAVEETTHADETRTLTHHITEGDAMKDYKKFDVIVET
NPKPNGHGSVVTYSIVYEKINEDSPAPFDYLKFFHQNIVDMSAHICSS
Ligand information
Ligand ID08N
InChIInChI=1S/C22H23NO7/c1-23-8-7-11-9-14-20(29-10-28-14)21(27-4)15(11)17(23)18-12-5-6-13(25-2)19(26-3)16(12)22(24)30-18/h5-6,9,17-18H,7-8,10H2,1-4H3/t17-,18+/m1/s1
InChIKeyAKNNEGZIBPJZJG-MSOLQXFVSA-N
SMILES
SoftwareSMILES
OpenEye OEToolkits 2.0.7CN1CCc2cc3c(c(c2C1C4c5ccc(c(c5C(=O)O4)OC)OC)OC)OCO3
OpenEye OEToolkits 2.0.7CN1CCc2cc3c(c(c2[C@@H]1[C@@H]4c5ccc(c(c5C(=O)O4)OC)OC)OC)OCO3
CACTVS 3.385COc1ccc2[C@H](OC(=O)c2c1OC)[C@@H]3N(C)CCc4cc5OCOc5c(OC)c34
ACDLabs 12.01COc1c2OCOc2cc2CCN(C)C(C3OC(=O)c4c(OC)c(ccc43)OC)c12
CACTVS 3.385COc1ccc2[CH](OC(=O)c2c1OC)[CH]3N(C)CCc4cc5OCOc5c(OC)c34
FormulaC22 H23 N O7
Namenoscapine;
(3S)-6,7-dimethoxy-3-[(5R)-4-methoxy-6-methyl-5,6,7,8-tetrahydro-2H-[1,3]dioxolo[4,5-g]isoquinolin-5-yl]-2-benzofuran-1(3H)-one
ChEMBLCHEMBL364713
DrugBankDB06174
ZINCZINC000019418974
PDB chain7uqn Chain A Residue 201 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7uqn Alkaloid binding to opium poppy major latex proteins triggers structural modification and functional aggregation.
Resolution1.7 Å
Binding residue
(original residue number in PDB)		I40 H42 W63 Y65 A74 E76 H89 I91 F142 F143
Binding residue
(residue number reindexed from 1)		I31 H33 W54 Y56 A65 E67 H80 I82 F133 F134
Annotation score1
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sun Feb 16 21:22:11 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '7uqn', asym_id = 'A', bs = 'BS01', title = 'Alkaloid binding to opium poppy major latex prot...ructural modification and functional aggregation.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='7uqn', asym_id='A', bs='BS01', title='Alkaloid binding to opium poppy major latex prot...ructural modification and functional aggregation.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0006952', uniprot = '', pdbid = '7uqn', asym_id = 'A'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0006952', uniprot='', pdbid='7uqn', asym_id='A')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>