Structure of PDB 7uo8 Chain A Binding Site BS01

Receptor Information

>7uo8 Chain A (length=174) Species: 90371 (Salmonella enterica subsp. enterica serovar Typhimurium) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MAVRLTFDGQKLTWPGIGIFKATTGLPDLQWPDKQCVPDAAIPEGNYKLF
IQFQGEAPIRNAADCDLGPSWGWSTIPRGQAAGTCEIYWANWGYNRIRLE
SADEKTRKACGGKRGGFYIHDSTKGYSHGCIEVEPVFFRILKQETEKENG
EKTFTVNVKYVSGQQTNGGTKQGE

Ligand information

>7uo8 Chain B (length=5) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

HHHHH

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7uo8 Molecular characterization of the type VI secretion system effector Tlde1a reveals a structurally altered LD-transpeptidase fold.
Resolution	1.6 Å
Binding residue (original residue number in PDB)	R61 D65 C66 D67 Y89 W93 G116 G117 C131
Binding residue (residue number reindexed from 1)	R60 D64 C65 D66 Y88 W92 G115 G116 C130

Enzymatic activity

Enzyme Commision number

External links

PDB	RCSB:7uo8, PDBe:7uo8, PDBj:7uo8
PDBsum	7uo8
PubMed	36183829
UniProt	H9L4J5

[Back to BioLiP]